PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G040508.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB
Protein Properties Length: 566aa    MW: 62315.5 Da    PI: 5.3478
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G040508.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.2e-184794148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT  Ede+l d+v+++G g+W+++ ++ g+ R++k+c++rw ++l
  HL.SW.v1.0.G040508.1 47 KGPWTSTEDEILMDYVNKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 94
                          79******************************************9986 PP

2Myb_DNA-binding46.96.4e-15100143146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +g+++++E+ l+++++ q+G++ W++ a+ ++ gRt++++k++w++
  HL.SW.v1.0.G040508.1 100 KGAFSQDEERLIIKLHSQMGNK-WARMASQLP-GRTDNEIKNYWNT 143
                           799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0154294IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-244597IPR009057Homeodomain-like
SuperFamilySSF466894.87E-3046141IPR009057Homeodomain-like
SMARTSM007177.0E-154696IPR001005SANT/Myb domain
PfamPF002494.7E-164794IPR001005SANT/Myb domain
CDDcd001674.85E-114994No hitNo description
PROSITE profilePS5129424.41495149IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2498148IPR009057Homeodomain-like
SMARTSM007172.4E-1599147IPR001005SANT/Myb domain
PfamPF002491.9E-13100143IPR001005SANT/Myb domain
CDDcd001671.09E-10102143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MVRWKKIKMS GSTNESEDGK ISKYHSDSPL IDDNNGGSSS GGLVLKKGPW TSTEDEILMD  60
YVNKHGEGNW NAVQKHSGLS RCGKSCRLRW ANHLRPNLKK GAFSQDEERL IIKLHSQMGN  120
KWARMASQLP GRTDNEIKNY WNTRIKRRQR AGLPLYPADL CLQACQENQG QSTGGINCGD  180
DGQNDPMQAN SFEIPDVVFK GLKANTDVLP YVSALPEMSM NSMLMKGIAS PQCYSFIPST  240
LNRHKRLRAT SDDFPDSSGC VQNGFPLFDQ CQVNCGKVVS PWSTFQHDLD PNKSLLSYDV  300
MQGSHALSNG NSSASKPIYG NVKLELPSLQ YTETDLGAWG TSPQPPLLES VDTYIHSPPT  360
VECSTPRNSG LLEDLLHESK NLGSGKKHLS EKSSNSSSIT PCDVVDNSPL NFCETEWEDY  420
RESPFCHSAT SLFNNECISN SGSSMEEPLP LNTFPGSTVK LEPFETDSVT TKERELSTQM  480
NIRPDALLGS EWFDQTTGYL DPTLVSDTIA TVLGDGLAND YNKHMASGTA SLGQEMMGFG  540
HCAWNAMPSD QQCLGNNYAF LNIER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31451485107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4560852e-36AM456085.1 Vitis vinifera contig VV78X211164.14, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015876156.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876155.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876154.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015876153.10.0PREDICTED: transcription factor GAMYB
TrEMBLW9QVM80.0W9QVM8_9R
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-110myb domain protein 65